NEWS

Address:
Liaoning province Dalian City Wafangdian Kowloon Office Yang Shugou
Tell:0411-85399638
Fax:0411-85399449
Postcode:116007

Your location:HOME > NEWS

NEWS

White Feather unlock the secrets of fast growing broilers

Modernbroilerfast growingmystery
In the early1980s, China beganfrom abroadwhite feather chickenbreeds.Broilercareerafterthirtyyears of development,broiler performancehas been greatly improved.In1984, broilergrow to2.0kgweightneed49 days,whilethe2010onlyneed34 days,26yearsto shorten the15 days,an average reduction ofabout0.58 daysper year.In other words, the same as49 days,1984broilerweighingonly2.0kg,whilethe2010broilerbody weightcan be achievedonly3.49kg.
Modernbroilerable togrowso fastthe mysteryof whatis it?
Tobreak thefast growingmodernbroilerssecret,we need to understandthe characteristics ofbroilerbreed, feed,broilerchickensenvironmental andhealth and epidemic preventionmeasuresto eat,and bywhat kind offeeding and managementtechniques toensure thatchickensgrow faster.
I.broilerbreedcharacteristics
Back in the earlylast century, peopleaccording to theirpersonal preferences, through theappearance andsizeof chickenand othertraitsof individualchoice.At that time, to asmallselectionof chickengrowth rate,the growth of chickenswhenthespeed is notfast.By the early1940sthe late1950s, with advances ingenetics and breedingtechnology,foreignprofessionalbroilerbreeding companiesbegan to engage inthe use ofquantitative geneticstechniquesto selectbroilermeat productionperformance.Inbroilerstock field,breedersestablished a largegroup ofpurebredstrains.Expertsbreedersbreedthemout of thenext generation ofcommercial broilersraised tomarket weightwhenthefast growth,feed conversionrate,bodydevelopment is good,the high rate ofproduction of meatchickenspickedout forbreeding.Modernbroilerbreedingselection intensityis particularly high,seedratebroilercoregroupofgenerallyless than1%rooster,hen7-8%paternal,maternalhenwas10-12%.This highintensitychoosefast growth,feedconversion rateofbroilersmethodensures therapid development ofgenebroilerbreeding,sothe performance ofafast growingmodernbroilergeneticpotential tocontinue to improve,broilerbody weightevery year40-45gprogressand feed conversionrate ofannualincrease~-0.025-0.02, ieeachcommoditybroilerto2.5kgeach yearcan savefeed50-65g,commercial broilerreachagebiennial2.5kgweightreduction of aboutone day.The originalbroilersreach2.5kgweightneed52 days,now just42 dayscan beachieved.Data shows thatbroilerbreedersbysix or sevenyears ofbreeding work,the growth rate ofthe modernbroilerhas progressed tothe end ofthe 1940s,three timesthe growth rate ofbroilers, the sameproduction1815gchicken,modernbroilerfeed consumptionratiothe last centurythe late1940sbroilerfeedconsumption is alsoreduced by 3times.
Controlbackyardchickenfarmervarietiesnow, sincethere is nofast-growingchickengene,its growthrate significantlybutit is verymodernbroilerthannormal.We can say thatthe modernbroilerable togrow sofastkey point is thatbroilerwith fast growth,feed conversionrateofgeneticvarieties.
Two.Broilerfeed
Inthe long-termbroilerpractice,it was foundto makeexcellentchickenfast growth,feedconversion rateofgeneticget to play, you needtobroilersfed thehigh-energyhigh-proteincomplete feed.Modernbroilernutritionexperts, based onthe characteristics andnutritional requirements ofbroilersat different stages ofgrowth and development,thecorn(2445,9.00,0.37%), soybean meal(3228,16.00,0.50%),fats, mineralsand trace elementssuch asfeed materialsfor scientificrecipes,made into anutritionally balancedcomplete feedtomeet the differentgrowth stagesofbroilernutritionrequirements.
Broilerfeedis usually divided intothree:
1chickenIngredients:chickenfeedcrude protein content of21-22%, which couldvalue of about3010kcal / kg.At the samedietrich inminerals andtrace elements such ascalciummineral elementscontent of1%,0.5%available phosphorus, magnesium and0.05%-0.5%,0.16%sodiumchloride0.16%-0.22%,potassium0.4%-0.9%,trace element contentof feedperkgofcopper8mg,iodine1mg,iron80mg,manganese100mg,molybdenum1mg,selenium0.15mg,zinc80mg.Typically, broilerchicksfedfeed1-14days.
2inchicken feed:broilersgrown to14 daysafter,seven daysprior toslaughterthis stage offeedingchickenfeed.Dietary proteincontentdecreasedat this stage,the energy content ofthe feedsignificantly increased.Typically,the crudeprotein contentin thechicken feedis about20%,energy valueof about3100 kcal / kg.Feedthe samecontent-richminerals and trace elementssuch ascalciummineral elementscontent of0.9%,0.45%available phosphorus, magnesium and0.05%-0.5%,0.16%sodiumchloride0.16%-0.22%,potassium0.4%-0.9%,trace element contentof feedperkgofcopper8mg,iodine1mg,iron80mg,manganese100mg,molybdenum1mg,selenium0.15mg,zinc80mg.
3largechicken feed:7daysprior toslaughterchickens,feedfedtobroilerchickenfeedtoreplacetheNational Cheng Kung University.Largechicken feedcrude proteincontent of 18% - 20%,energy valueof around3200 kcal / kg.Minerals andtrace elements indietaryadequacy,mineral elementssuch ascalciumcontent of0.985%,0.42%available phosphorus, magnesium and0.05%-0.5%,0.16%sodiumchloride0.16%-0.22%,potassium0.4%-0.9%,trace element contentof feedperkgofcopper8mg,iodine1mg,iron80mg,manganese100mg,molybdenum1mg,selenium0.15mg,zinc60mg.
It is thishigh-energyhigh-proteinnutritional balanceofthe full priceof feedforbroiler chickenshealthy and rapidgrowthprovides the materialfoundation for thegrowth rate ofbroilerswith afast,highfeed conversiongenescanplay itsgeneticpotential.Obviously,the samebroilerbreed, if you uselow-energylow-proteindiet(such as usinga simplecornor wheat(2514,3.00,0.12%))werefed,because of thisfeedenergysubstancesnot meetthe rapid growth ofbroiler chickensrequiredevelopment,broilerwill"make brickswithout straw,"feeding3-4kgcornor wheatalsodifficult to obtain1kgofweight gain,and it certainlywillgrowupunhappy.
Three.Broilerrearing environment
Newbornchicksbody temperatureat39.4 ℃ -between41.1 ℃,less subcutaneous fat,relatively fewhairs,poorinsulation,the temperatureusing the energyproductioncapacity is alsopoor.Broiler28daysafterthe beginning ofthe longfeatherstogether,thermoregulatorymechanisms are beginning tosound,began toadapt to theenvironment.At the same timedue to therapidgrowth ofbroiler chickenshavegenes, but alsofednutritionally balancedproteinenergyvalueofthe full price offeed,broileritselfparticularly fastmetabolic rate, temperature,keepingitsenvironment,humidity and airquality requirementsare particularly high.Theseenvironmental controlsto meet therequirementsof broilers,broilerhealthy and rapidgrowthis guaranteed.
1Temperature:1day old chicksambienttemperature controlin34-35 ℃.7-day-oldchickswhenthe ambient temperatureis graduallylowered to32 ℃.After thechicksincreaseswithage, theweeklydecline intemperature2-3 ℃,35days oldwhen thehouse temperaturecontrolat21 ℃.Meanwhile, in thelowerhousewhenthe ambient temperature,the expertisgradually reducedbroilershedsambient temperature,the temperature difference betweendayshedsno more than1 ℃,so as not tocausestresstothe coldchicken.
2Humidity:Humidity Controlbroilersin the first weekat 60% -65%.Aftergrowing upwithchickens, humiditygraduallyreduced to45%-65%.
3Ventilation:rapidgrowth rateof broilersandbroilervigorousmetabolismso thatat least0.5-0.6cfm / kgofventilation.In addition tonormal growth and developmentof broilerairvolume requirements, but moreimportant is theairquality.Expertsbroilerautomaticventilationequipment to controlventilationcooptime,ensurethe airinside thehouseis greater than19.6 percentoxygen content, carbon dioxideconcentrations of less than0.3%, ammoniaand carbon monoxideconcentrations below10ppm,the dustis less than3.4 mg / m3.
Automaticclimate controlsysteminstalledmodernbroiler housescan be easily realizedbroiler housetemperature and humidityand ventilationrequirements forhealthy and rapidgrowth ofbroilerprovide protection.The previousruralindigenouschickens, not to mentionenvironmental controlsheds.In many cases,what thetemperature isoutsidewhattemperaturethe chicken.Impropertemperatures willcausethe chickensfeedin the feedenergy intothe need to maintainbody temperature, thusreducingcreatechickenfeed efficiencyand growthslow.Whilekeepingthe environmental impactbecause of poorhealth of the chickens,even if wekeptthe samebreed,fedthe samediet, growth and developmentof chickenswill beslow.
Four.Health and epidemic preventionmeasures
Health and epidemic preventionmeasuresis an importantfactor inbroilerchickensrapidgrowth and developmentofprotection.Modernbroiler farmbuiltaway from thepeople's productionand livingarea,a fullyenclosedall-outfeeding and managementmodel, throughgoodimplementationpathogensisolation, disinfectionof goods andvehicles,personnel access control,immunizationprogramschickens,chickensworkingscientific medicineandhealth monitoringand other aspectsto ensurethe health ofbroilers,sofarthe impactof the diseaseandbroilergrow faster.
V.scientificfeeding and managementtechniques
Broilerexpertsworkindecades, and foundin line withthegrowth and development ofbroilerfeeding and managementtechniques, especiallyto improvebroiler7-day weightand lightcontrol technologyapplications, makingbothbroilersgrow faster, but alsoto grow up.
1raisebroiler7-day weight:studybroilerrearingexpertsfound thatbody weightperday-oldbroiler7difference between1g,will lead toslaughter weightdifference of6.7g.In order to improvethe7-day-oldbroilerweight,we givethe chicksfedwithinsix hoursafter thechickshatched,the chicksdigestive tractto stimulatethe development andnurturingchicksproduce goodappetite.Meanwhile, despiteaday-old chicksintakeat around15g,in thethree daysbefore thebrood,we not onlyuseoneevery70-80chicksfeedingtrays, butstillbelow thefeed lineon both sidescovered withmatsorwaterlinepaper,pad of paperfeedingareaarea accounts for1 / 3-1/2,sprinkleabout60gofeachchickenpadof paperfeeding amounttoallowthe chicksad libitum.This approachallowschickenseatfeedas possible.Taking into accountjusthatchedchickstimid,weak constitutionphysiological characteristics, they needplenty of lighttoincreaseintake.In thechickencoopinto thefirst two days, the implementation of24 hoursofexposure time, light intensity60luxto ensurechicksand moreactivities, morefeed.Afterthe firstthree days, and then graduallyreduce theexposure timeand light intensity, light intensityand graduallyreduced from60luxto30lux,reducing theexposure timeisusuallyone houra day.Modernbroilertosevendays,itsweightcan reach more thanfourtimes the weightof 1 day, even to210g.Excellentbroilerchickens7-day weightmeans thatbroodingstagein thegrowth and development ofgood,and lay a solidfoundation for futuregrowth and development.
2lightingcontrol technology:broilergrowthto7daysaftertheirmuscles,bones andfeathersgrowth ratesignificantly accelerated, so thatthe various organs ofthe bodyis always ina stateof stress, especiallyheart and lungfunction is oftenneededto keep upmetabolism,this timeitis prone tosudden death syndromein broilersuniqueandascites.Meanwhile,with respect to therapidgrowthofmuscle, thebroilerbone developmentbecomesPianman, thenthere willbroilerleg problems.To addressthe rapidgrowth ofbroilerbringssudden deathsyndrome,ascitesandleg problems, we adoptedthe use oflightingcontrol technology,namelyby reducing thelight intensity,reducingexposure timeto reduce theintakeof chicks.Whenreducingfeed intake, growth rateisslowed down,so thatthe development ofbroilermuscle,bone growthand developmentof the cardiovascular systemandmore balanced,alsoimprovedthe survival rate ofbroilers.Typically, when thebroilerweighing167g,wewillcontrolthe light intensityin5-10lux,illumination timewas reduced to18 hours;broiler8-21days oldat the time,illumination timeand thenreduced to16-12hours;broiler22-35daysage, theexposure timeto18 hours;and whenthe35-day-oldbroilerafterone hourofexposure timeincreasesevery day,untilincreased to23 hoursofillumination time.In other words,seven daysprior toslaughter,to promotebroilerfeedby increasing theexposure timeto achievethe purpose ofrapidweight gain,weightlossremedyin therearingof broilersbecause of reducedexposure timeearlylead.
In addition, themodernbroilerfarm installationautomatedfeeding systemanddrinking watersystems to reducewaterwastematerial,but also to ensurefeed and waterhygiene, reducing theoccurrence ofthe diseasein chickens.Widespread use ofthis automaticfeeding system, so thatbroilerlaborefficiency is greatly improved, large-scalebroiler productionhas been developing rapidly.
Through the abovefive aspectsofunderstanding, weknowthemodernbroilercangrowso fastthat thekey pointsof thisbreedbroilerwith fast growth,feedconversion rateofthe gene.Peoplefed tobroilerfull price ofhigh-energyhigh-proteinfeed,broilerwithintheappropriatetemperature and humidityandwell-ventilatedsheds,throughgoodhealth and epidemic preventionwork and theimplementation of scientificfeeding and managementtechniques,geneticvarietiesmake excellentbroilerplay out.Modernfast-growingbroilerHere lies the secret!
Afterbreakfast growingmodernbroilersmysteries,forfolk"fast growingbroilersarefedout of theuse of hormones," therumorsarenotoffensiveandbroke!Since thechickenhas"athird year low," thenutritional characteristics ofhigh protein,low fat, lowcalorie, lowcholesterol, chickenbegan tobecomemost people welcomehealthymeat.Withsafe,healthyconsumption conceptis gaining in popularity, China'schickenconsumptionwillmaintain a goodmomentum of development,broilerindustry willbe bigger and bigger.